Talk to our Marriage Counsellor in Mumbai and get suitable Marriage Help to save your Marriage. Wow now is the best in Marriage Counseling Services in Mumbai for couples. Get ways to have a better married life.

3.90 Rating by CuteStat

wownow.net.in is 7 years 3 weeks old. It is a domain having net.in extension. It has a global traffic rank of #8137079 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, wownow.net.in is SAFE to browse.

PageSpeed Score
56
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 103
Daily Pageviews: 206

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 416,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 8,137,079
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

207.174.214.245

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 8
H3 Headings: 2 H4 Headings: 10
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 9
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 207.174.214.245)

A Marketing Automation Blog

- amarketingautomation.com
Not Applicable $ 8.95

News Feed - the cure is within you

- nvlife.net
Not Applicable $ 8.95

Best Commercial Laundry Services in Delhi, NCR - CLPPL

- centrallinenpark.com

Central Linen Park is one of the leading commercial laundry service providers in Delhi NCR. 40 tons of daily processing capacity. Call us at 9560792972

Not Applicable $ 8.95

Under Construction

- sarkaridost.com
Not Applicable $ 8.95

Waytocrack.com

- waytocrack.com

Programming, Design and Development,interview Question , Data Structure, Algorithm , Computer Science

836,856 $ 960.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 01 Jan 2020 14:45:41 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Thu, 22 Nov 2018 05:13:09 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 6118
Content-Type: text/html

Domain Information

Domain Registrar: Endurance Domains Technology LLP
Registration Date: Mar 29, 2017, 3:18 PM 7 years 3 weeks 3 days ago
Expiration Date: Mar 29, 2020, 3:18 PM 4 years 3 weeks 6 days ago
Domain Status:
clienttransferprohibited

DNS Record Analysis

Host Type TTL Extra
wownow.net.in A 10800 IP: 207.174.214.245
wownow.net.in NS 86400 Target: ns1.cp-36.bigrockservers.com
wownow.net.in NS 86400 Target: ns2.cp-36.bigrockservers.com
wownow.net.in SOA 10800 MNAME: ns1.cp-36.bigrockservers.com
RNAME: sales.bigrock.in
Serial: 2019090400
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
wownow.net.in MX 14400 Target: wownow.net.in
wownow.net.in TXT 14400 TXT: v=spf1 a mx include:webhostbox.net ~all

Similarly Ranked Websites

Stoltz Management

- investorportal.stoltzusa.com
8,137,080 $ 240.00

ecotopianetwork

- ecotopianetwork.wordpress.com
8,137,099 $ 240.00

Film izle, HD Film izle, Sinema izle, Film Seyret

- filmifullhdizlet.com

Yepyeni vizyona girmiş yerli ve yabancı filmleri ister türkçe dublaj ister türkçe altyazılı olarak izleyebileceğiniz muhteşem bir portal

8,137,101 $ 8.95

Completely FREE Software - Windows & DOS freeware

- completelyfreesoftware.com

Freeware heaven! A fabulous selection of completely free Windows & DOS software - tested, reviewed and rated.

8,137,108 $ 240.00

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Full WHOIS Lookup

Domain Name: wownow.net.in
Registry Domain ID: D414400000003745646-IN
Registrar WHOIS Server:
Registrar URL: https://publicdomainregistry.com/
Updated Date: 2019-02-27T09:22:45Z
Creation Date: 2017-03-29T09:33:20Z
Registry Expiry Date: 2020-03-29T09:33:20Z
Registrar: Endurance Domains Technology LLP
Registrar IANA ID: 801217
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: N/A
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Other
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns1.wownow.net.in
Name Server: ns2.wownow.net.in
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-01-01T14:45:49Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or Neustar except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.